RecombinantMIP-1alpha/CCL3,Mouse

Artikelnummer: BWT-BK0322
Artikelname: RecombinantMIP-1alpha/CCL3,Mouse
Artikelnummer: BWT-BK0322
Hersteller Artikelnummer: BK0322
Alternativnummer: BWT-BK0322-25UG,BWT-BK0322-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
MIP-1 alpha/CCL3, also known as LD78 alpha, is an inflammatory chemokine. MIP-1alpha belongs to the CCL chemokine family, and shares 68% homology with MIP-1beta. The mature form of MIP-1alpha contains 69 amino acids, exists as dimers in solution, and tends to undergo reversible aggregation. The receptors of MIP-1alphain vivo are mainly the G-protein coupled receptors CCR1 and CCR5. Upon stimulation by endogenous and exogenous agents such as Interleukin-1beta, Interferon-gamma, and lipoteichoic acid from gram-positive bacteria, monocytes are able to secrete significant amounts of MIP-1alpha. MIP-1alpha augments the adhesions of T lymphocytes, monocytes, and neutrophils to vascular cell adhesion molecule 1. Additionally, in wounds, MIP-1alphachemoattracts macrophages in order to accelerate the tissue repair process.Recombinant Mouse MIP-1 alpha/CCL3 (rmMIP-1alpha) produced in HEK 293cells is a single polypeptide chain containing 69 amino acids. A fully biologically active molecule, rmMIP-1alphahas a molecular mass of 7.8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molekulargewicht: 7.8 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE and HPLC.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.