RecombinantMIP-3alpha/CCL20,Rat

Artikelnummer: BWT-BK0324
Artikelname: RecombinantMIP-3alpha/CCL20,Rat
Artikelnummer: BWT-BK0324
Hersteller Artikelnummer: BK0324
Alternativnummer: BWT-BK0324-25UG,BWT-BK0324-5UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Macrophage Inflammatory Protein-3 (MIP-3alpha), also known as chemokine (C-C motif) ligand 20 (CCL20) or liver activation regulated chemokine (LARC), is a small cytokine belonging to the CC chemokine family. It is strongly chemotactic for lymphocytes and weakly attracts neutrophils. MIP-3alphais implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells toward the epithelial cells surrounding these tissues. MIP-3alphais expressed in the liver, lymph nodes, appendix, PBL and lung and can signal through the CCR6 receptor.Recombinant rat MIP-3 alpha/CCL20 produced in HEK293 cells is a polypeptide chain containing 71 amino acids. A fully biologically active molecule, rrMIP-3 alpha/CCL20 has a molecular mass of 8.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molekulargewicht: 8.2 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 98% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: ASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRIL HLLSLRTKKM
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.