RecombinantPDGF-CC,Human

Artikelnummer: BWT-BK0327
Artikelname: RecombinantPDGF-CC,Human
Artikelnummer: BWT-BK0327
Hersteller Artikelnummer: BK0327
Alternativnummer: BWT-BK0327-10UG,BWT-BK0327-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Platelet-Derived Growth Factor (PDGF) is a potent mitogen for a wide range of cell types including fibroblasts, smooth muscle, connective tissue, bone and cartilage cells, and some blood cells. The PDGF is involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. The PDGF family consists of proteins derived from four genes (PDGF -A, -B, -C, and -D) that form four disulfide-linked homodimers (PDGF-AA, -BB, -CC, and -DD) and one heterodimer (PDGF-AB).
Molekulargewicht: 15~19 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPK TGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.