RecombinantVEGF165,Human(HEK293-expressed)

Artikelnummer: BWT-BK0335
Artikelname: RecombinantVEGF165,Human(HEK293-expressed)
Artikelnummer: BWT-BK0335
Hersteller Artikelnummer: BK0335
Alternativnummer: BWT-BK0335-10UG,BWT-BK0335-1MG,BWT-BK0335-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors, fms-like tyrosine kinase (flt-1), KDR gene product (the mouse homolog of KDR is the flk-1 gene product) and the flt4 gene product.
Molekulargewicht: 20~26 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRC DKPRR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.