RecombinantVEGF-C,Human

Artikelnummer: BWT-BK0336
Artikelname: RecombinantVEGF-C,Human
Artikelnummer: BWT-BK0336
Hersteller Artikelnummer: BK0336
Alternativnummer: BWT-BK0336-10UG,BWT-BK0336-1MG,BWT-BK0336-50UG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D).Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.
Molekulargewicht: 16~19 kDa, observed by reducing SDS-PAGE.
Quelle: HEK 293
Reinheit: > 95% as analyzed by SDS-PAGE.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR
Formel: Lyophilized after extensive dialysis against PBS.
Anwendungsbeschreibung: Reconstituted in ddH2O or PBS at 100 µg/ml.