Anti-imipenemase metallo-beta-lactamase (IMP), Rabbit mAb, Unconjugated

Artikelnummer: BWT-MB67275
Artikelname: Anti-imipenemase metallo-beta-lactamase (IMP), Rabbit mAb, Unconjugated
Artikelnummer: BWT-MB67275
Hersteller Artikelnummer: MB67275
Alternativnummer: BWT-MB67275-50UL,BWT-MB67275-100UL
Hersteller: Bioworld Technology
Kategorie: Antikörper
Applikation: ELISA, WB
Immunogen: MSKLSVFFIFLFCSIATAAEPLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVDAEAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSQSIPTYASELTNELLKKDGKVQAKNSFGGVNYWLVKNKIEVFYPGPGHTPDNLVVWLPERKILFGGCFIKPYGLGNLGDANLEAWPKSAKLLISKYGKAKLVVPSHSEAGDASLLKLTLEQAVKGLNESKKPSKLSNHHHHHH
Konjugation: Unconjugated
Rabbit IgG1, Kappa
UniProt: HAS1313528.1
Reinheit: The antibody was affinity-purified by protein A and the purity is > 95% (by SDS-PAGE).
Formulierung: 1mg/ml in PBS,pH7.4
Application Verdünnung: WB: 1:500~1:2000 ELISA: 1:5000~10000
Anwendungsbeschreibung: Using phage display technology, library of antibody was constructed from peripheral blood of New Zealand rabbits which had been immunized by IMP protein. Screening the library with recombinant IMP protein, the target antibody was obtained and then was purified by recombinant and expression.