CD204 Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0326
Artikelname: CD204 Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0326
Hersteller Artikelnummer: NCP0326
Alternativnummer: BWT-NCP0326-500UG,BWT-NCP0326-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
Macrophage Scavenger receptor types I and II (MSR1, and also known as SCARA1) are members of the class A macrophage scavenger receptor family. These proteins bind large quantities of modified lipoproteins and promote endocytosis. Upregulation of MSR1 in infiltrating myeloid cells may mediate clearance of specific damage signals in response to tissue injury, including ischemic stroke. MSR1 germ line mutations are also associated with increased prostate cancer susceptibility in some patient cohorts. MSR1 is observed to be upregulated in differentiated THP-1 cells.
Molekulargewicht: ~40kDa
Tag: His-tag
UniProt: P21757
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: KWETKNCSVSSTNANDITQSLTGKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLM DTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIEN LNGKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLNNITNDLRL KDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGPIGPPGLKGDRGAIGFPGS RGLPGYAGRPG