CD300LB Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0344
Artikelname: CD300LB Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0344
Hersteller Artikelnummer: NCP0344
Alternativnummer: BWT-NCP0344-500UG,BWT-NCP0344-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
CD300LB, also known as CD300b, LMIR5, CLM-7, and IREM-3, is a glycoprotein member of the immunoglobulin superfamily. LMIR5 is expressed on the surface of myeloid lineage cells. It forms noncovalent cis-homodimers and cis-heterodimers with other CD300 family proteins, and the composition of these dimers affects the cellular response. Antibody cross-linking of LMIR5 induces mast cell granule release and cytokine production as well as its tyrosine phosphorylation of LMIR5 (in human). LMIR5 interacts with TIM1 and TIM4 which regulate T cell activation and are themselves binding partners. TIM1 interactions with LMIR5 mediate mast cell activation and the accumulation of neutrophils at sites of TIM1 up-regulation on damaged renal tubule epithelial cells. Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.
Molekulargewicht: ~18kDa
Tag: His-tag
UniProt: J9JID3
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: MIQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY