CD300c Recombinant Protein, E. coli

Produktübersicht

• Artikelname: CD300c Recombinant Protein, E. coli
• Artikelnummer: BWT-NCP0347
• Hersteller Artikelnummer: NCP0347
• Alternativnummer: BWT-NCP0347-500UG,BWT-NCP0347-1MG
• Hersteller: Bioworld Technology
• Wirt: E. coli
• Kategorie: Proteine/Peptide

Produktbeschreibung

CD300 molecules comprise a family of receptors that regulate many immune cell processes. Cross-linking of CD300C by its specific antibody caused cytokine/chemokine production of human monocytes and mast cells. specific engagement of CD300C led to Fc receptor gamma-dependent activation of mast cells and monocytes.

Produkteigenschaften

• Molekulargewicht: ~24kDa
• Tag: His-tag
• UniProt: Q08708
• Puffer: PBS, 4M Urea, PH7.4
• Expression System: pet-22b(+)
• Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Sequenz: MGYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVR