CD304 Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0366
Artikelname: CD304 Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0366
Hersteller Artikelnummer: NCP0366
Alternativnummer: BWT-NCP0366-500UG,BWT-NCP0366-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
Class 3 secreted semaphorin (Sema3A) is a chemorepellent that acts upon a wide variety of axons. As such, it induces a dramatic redistribution and depolymerization of actin filaments that results in growth cone collapse. Plexins are single pass, transmembrane signaling proteins encompassing Plexin A1, A2, A3 and A4. Plexins form a complex with neuropilin-1 and -2 and the cell adhesion protein L1 to form a functional semaphorin receptor. The GTPase Rnd1 binds to the cytoplasmic domain of Plexin A1 to trigger cytoskeletal collapse. In contrast, the GTPase RhoD blocks Rnd1-mediated Plexin A1 activation and repulsion of sympathetic axons by Sema3A. Neuropilin-1, a single pass transmembrane glycoprotein, was originally identified as a semaphorin receptor mediating axon growth cone collapse. In addition, neuropilin-1 is involved in axonal fasciculation, neuronal migration, dendritic guidance and repair of the adult nervous system. Neuropilin-1 is also an isoform-specific VEGF receptor on tumor and endothelial cells. Loss of neuropilin-1 function causes vascular remodeling and branching defects, which is compounded by additional loss of neuropilin-2 function.
Molekulargewicht: ~100kDa
Tag: His-tag
UniProt: O14786
Puffer: PBS, 4M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: MFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKC