CD212 Recombinant Protein, E. coli

Produktübersicht

• Artikelname: CD212 Recombinant Protein, E. coli
• Artikelnummer: BWT-NCP0380
• Hersteller Artikelnummer: NCP0380
• Alternativnummer: BWT-NCP0380-500UG,BWT-NCP0380-1MG
• Hersteller: Bioworld Technology
• Wirt: E. coli
• Kategorie: Proteine/Peptide

Produktbeschreibung

Functions as an interleukin receptor which binds interleukin-12 with low affinity and is involved in IL12 transduction. Associated with IL12RB2 it forms a functional, high affinity receptor for IL12. Associates also with IL23R to form the interleukin-23 receptor which functions in IL23 signal transduction probably through activation of the Jak-Stat signaling cascade.

Produkteigenschaften

• Molekulargewicht: ~52kDa
• Tag: His-tag
• UniProt: P42701
• Puffer: PBS, 4M Urea, PH7.4
• Expression System: pet-22b(+)
• Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Sequenz: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGT