SMAD9 Recombinant Protein, E. coli
Artikelnummer:
BWT-NCP0405
| Artikelname: |
SMAD9 Recombinant Protein, E. coli |
| Artikelnummer: |
BWT-NCP0405 |
| Hersteller Artikelnummer: |
NCP0405 |
| Alternativnummer: |
BWT-NCP0405-500UG,BWT-NCP0405-1MG |
| Hersteller: |
Bioworld Technology |
| Wirt: |
E. coli |
| Kategorie: |
Proteine/Peptide |
| Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD9 is a receptor-regulated SMAD (R-SMAD). |
| Molekulargewicht: |
~55kDa |
| Tag: |
His-tag |
| UniProt: |
O15198 |
| Puffer: |
PBS, 4M Urea, PH7.4 |
| Expression System: |
pet-22b(+) |
| Reinheit: |
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Sequenz: |
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALSCPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDSFQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQSGQPVDATADRHVVL |
