A36R-EEV Recombinant Protein, E. coli

Artikelnummer: BWT-NCP0431
Artikelname: A36R-EEV Recombinant Protein, E. coli
Artikelnummer: BWT-NCP0431
Hersteller Artikelnummer: NCP0431
Alternativnummer: BWT-NCP0431-500UG,BWT-NCP0431-1MG
Hersteller: Bioworld Technology
Wirt: E. coli
Kategorie: Proteine/Peptide
Monkeypox is a rare zoonosis caused by monkeypox virus, which has become the most serious orthpoxvirus and consists of complex double stranded DNA. The cases are mostly in central and western Africa. The pathogenesis of monkeypox is that the virus invades the body from respiratory mucosa , multiplies in lymphocytes, and incurs into blood producing transient venereal toxemia. after the virus multiplies in cells, the cells can invade the blood and propagate to the skin of the whole body, causing lesions.
Molekulargewicht: ~13kDa
Tag: His-tag
UniProt: Q5IXM9
Puffer: 2M Urea, PH7.4
Expression System: pet-22b(+)
Reinheit: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
Sequenz: HMYREELMPSACANGWIQYDKHCYLDTNIKMSTDNAVYQCRKLRARLPRPDTRHLRVLFSIFYKDYWVSLKKTNDKWLDINNDKDIDISKLTNFKQLNSTTDSEACYIYKSGKLVKTVCKSTQSVLCVKRFYKLE