Recombinant Human Glia Maturation Factor beta (rHuGMF-beta)

Artikelnummer: BWT-PR1033
Artikelname: Recombinant Human Glia Maturation Factor beta (rHuGMF-beta)
Artikelnummer: BWT-PR1033
Hersteller Artikelnummer: PR1033
Alternativnummer: BWT-PR1033-2UG,BWT-PR1033-10UG,BWT-PR1033-1.0MG
Hersteller: Bioworld Technology
Kategorie: Biochemikalien
GMF-beta, a brain-specific protein that belongs to the actin-binding proteins (ADF) structural family. GMF-beta appears to play a role in the differentiation, maintenance, and regeneration of the nervous system. It also supports the progression of certain auto
Molekulargewicht: Approximately 16.5 KDa, a single non-glycosylated polypeptide chain containing 141 amino acids.
Quelle: Escherichia coli.
Reinheit: >98% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDELPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQT AELTKVFEIRNT EDLTEEWLREKLGFFH
Formel: Lyophilized from a 0.2m filtered concentrated solution in 20mM PB, pH 7.4, 130mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportio