Recombinant Human I-TAC (rHuI-TAC/CXCL11)

Artikelnummer: BWT-PR1076
Artikelname: Recombinant Human I-TAC (rHuI-TAC/CXCL11)
Artikelnummer: BWT-PR1076
Hersteller Artikelnummer: PR1076
Alternativnummer: BWT-PR1076-5UG,BWT-PR1076-20UG,BWT-PR1076-1.0MG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
CXCL11 cDNA encodes a 94 amino acid (aa) residue precursor protein with a 21 aa residue putative signal sequence, which is cleaved to form the mature 73 aa residue protein. CXCL11 shares 36% and 37% amino acid sequence homology with IP-10 and MIG (two other known human non-ELR CXC chemokines), respectively. CXCL11 is expressed at low levels in normal tissues including thymus, spleen and pancreas. The expression of CXCL11 mRNA is radically up regulated in IFN-gamma and IL-1 stimulated astrocytes. Moderate increase in expression is also observed in stimulated monocytes. CXCL11 has potent chemoattractant activity for IL-2 activated T cells and transfected cell lines expressing CXCR3, but not freshly isolated T-cells, neutrophils or monocytes.
Molekulargewicht: 8.3 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 100mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.