Recombinant Human Lymphotactin (rHuLymphotactin/XCL1)

Produktübersicht

• Artikelname: Recombinant Human Lymphotactin (rHuLymphotactin/XCL1)
• Artikelnummer: BWT-PR1082
• Hersteller Artikelnummer: PR1082
• Alternativnummer: BWT-PR1082-5UG,BWT-PR1082-20UG,BWT-PR1082-500UG
• Hersteller: Bioworld Technology
• Kategorie: Proteine/Peptide

Produktbeschreibung

Lymphotactin is the only known member of the C-chemokine family and signals through the receptor XCR1, formally known as GPR5. The spleen shows the highest level of lymphotactin compared to peripheral leukocytes, lung, colon and small intestine. Lymphotactin is chemotactic towards lymphocytes but not towards monocytes or neutrophils.

Produkteigenschaften

• Molekulargewicht: 10.0 kDa, a single non-glycosylated polypeptide chain containing 92 amino acids.
• Quelle: Escherichia coli
• Reinheit: >97% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: GSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
• Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.4, 150mM NaCl.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.