Recombinant Human MIG (rHuMIG/CXCL9)

Artikelnummer: BWT-PR1091
Artikelname: Recombinant Human MIG (rHuMIG/CXCL9)
Artikelnummer: BWT-PR1091
Hersteller Artikelnummer: PR1091
Alternativnummer: BWT-PR1091-5UG,BWT-PR1091-20UG,BWT-PR1091-1.0MG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
CXCL9, a member of the alpha subfamily of chemokines that lack the ELR domain, was initially identified as a lymphokine-activated gene in mouse macrophages. The CXCL9 gene is induced in macrophages and in primary glial cells of the central nervous system specifically in response to IFN-gamma. CXCL9 has been shown to be a chemoattractant for activated T-lymphocytes and TIL but not for neutrophils or monocytes. The human CXCL9 cDNA encodes a 125 amino acid residue precursor protein with a 22 amino acid residue signal peptide that is cleaved to yield a 103 amino acid residue mature protein. CXCL9 has an extended carboxy-terminus containing greater than 50% basic amino acid residues and is larger than most other chemokines. A chemokine receptor (CXCR3) specific for CXCL9 and IP-10 has recently been cloned and shown to be highly expressed in IL-2-activated T-lymphocytes.
Molekulargewicht: 11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
Quelle: Escherichia coli.
Reinheit: >97% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Formel: Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH 7.4, 50mM NaCl.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.