Recombinant Human NOGGIN (rHuNOGGIN )

Artikelnummer: BWT-PR1103
Artikelname: Recombinant Human NOGGIN (rHuNOGGIN )
Artikelnummer: BWT-PR1103
Hersteller Artikelnummer: PR1103
Alternativnummer: BWT-PR1103-5UG,BWT-PR1103-20UG,BWT-PR1103-1.0MG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Noggin belongs to a group of diffusible proteins which bind to ligands of the TGF-beta family and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures. Consequently, Noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of Noggin in mice results in prenatal death and recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing Noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis.
Molekulargewicht: Approximately 46.2 kDa non-disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.
Quelle: Escherichia coli.
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCG WIPIQYPIIS ECKCSC
Formel: Lyophilized from a 0.2µm filtered concentrated solution in 30% acetonitrile, 0.1% TFA.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.