Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.)

Produktübersicht

• Artikelname: Recombinant Human Oncostatin-M(209a.a.) (rHuOSM 209a.a.)
• Artikelnummer: BWT-PR1105
• Hersteller Artikelnummer: PR1105
• Alternativnummer: BWT-PR1105-2UG,BWT-PR1105-10UG,BWT-PR1105-1.0MG
• Hersteller: Bioworld Technology
• Kategorie: Proteine/Peptide

Produktbeschreibung

Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activated T cells, monocytes and Kaposis sarcoma cells, OSH can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposis sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells. OSM share several structural and functional characteristics with LIF, IL-6, and CNTF. Human OSM is active on murine cells.

Produkteigenschaften

• Molekulargewicht: Approximately 23.9 kDa, a single non-glycosylated polypeptide chain containing 209 amino acids.
• Quelle: Escherichia coli.
• Reinheit: >97% by SDS-PAGE and HPLC analyses.
• Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
• Sequenz: AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRRHSPHQALRKGVRR
• Formel: Lyophilized from a 0.2µm filtered concentrated solution in PBS, pH 7.4.

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.