Recombinant Murine Interferon-gamma (rMuIFN-gamma)

Artikelnummer: BWT-PR2019
Artikelname: Recombinant Murine Interferon-gamma (rMuIFN-gamma)
Artikelnummer: BWT-PR2019
Hersteller Artikelnummer: PR2019
Alternativnummer: BWT-PR2019-20UG,BWT-PR2019-100UG,BWT-PR2019-1.0MG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Interferon-gamma (IFN-gamma, also known as Type II interferon or immune interferon) is a cytokine produced primarily by T-lymphocytes and natural killer cells. The protein shares no significant homology with IFN-beta or the various IFN-alpha family proteins. Mature IFN-gamma exists as noncovalently-linked homodimers. Human IFN-gamma is highly species specific and is biologically active only in human and primate cells.IFN-gamma was originally characterized based on its antiviral activities. The protein also exerts antiproliferative, immunoregulatory and proinflammatory activities and is thus important in host defense mechanisms. IFN-gamma induces the production of cytokines, upregulates the expression of class I and II MHC antigens, Fc receptor and leukocyte adhesion molecules. It modulates macrophage effector functions, influences isotype switching and potentiates the secretion of immunoglobulins by B cells. IFN-gamma also augments TH1 cell expansion and may be required for TH1 cell differentiation.
Molekulargewicht: Approximately 15.6 kDa, a single non-glycosylated polypeptide chain containing 134 amino acids.
Quelle: Escherichia coli.
Reinheit: >95% by SDS-PAGE and HPLC analyses
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
Formel: Lyophilized from a 0.2mm filtered solution in PBS, pH 7.4, containing 5% trehalose.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.