Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)

Artikelnummer: BWT-PR6001
Artikelname: Recombinant Cyclin-Dependent Kinase Inhibitor 2A (rHuP16-INK4a)
Artikelnummer: BWT-PR6001
Hersteller Artikelnummer: PR6001
Alternativnummer: BWT-PR6001-10UG,BWT-PR6001-50UG,BWT-PR6001-1.0MG
Hersteller: Bioworld Technology
Kategorie: Proteine/Peptide
Cyclin-dependent kinase inhibitors (CDKIs) are proteins that bind to and inhibit the activity of CDKs. Two major classes of CDK inhibitors have been identified. The p16 family (p15, p16, p18 and p19) binds to and inhibits the activities of CDK4 and CDK6. The p21 family (p21, p27, p28 and p57) can bind to broad range of CDK-cyclin complexes and inhibit their activities. CDKIs are capable of suppressing growth, and several lines of evidence strongly suggest that at least some CDKIs may be tumor suppressor proteins.
Molekulargewicht: Approximately 16.5 kDa, a single non-glycosylated polypeptide chain containing 156 amino acids.
Quelle: Escherichia coli
Reinheit: >95% by SDS-PAGE and HPLC analyses.
Formulierung: Sterile Filtered White lyophilized (freeze-dried) powder.
Sequenz: MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE LGHRDVARYL RAAAGGTRGS NHARIDAAEG PSDIPD
Formel: Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20C. Further dilutions should be made in appropriate buffered solutions.