Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

Artikelnummer: BYT-ORB1095862
Artikelname: Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)
Artikelnummer: BYT-ORB1095862
Hersteller Artikelnummer: orb1095862
Alternativnummer: BYT-ORB1095862-1,BYT-ORB1095862-100,BYT-ORB1095862-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
This Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active) spans the amino acid sequence from region 23-163aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 44.1 kDa
UniProt: Q9H665
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 µg/mL can bind Human IGFL1, the EC50 is 4.640-5.722 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 µg/ml can bind Human IGFL1, the EC50 is 4.640-5.722 ng/mL.