Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)

Artikelnummer: BYT-ORB1095868
Artikelname: Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active)
Artikelnummer: BYT-ORB1095868
Hersteller Artikelnummer: orb1095868
Alternativnummer: BYT-ORB1095868-1,BYT-ORB1095868-100,BYT-ORB1095868-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Human Insulin growth factor-like family member 1 (IGFL1) (Active) spans the amino acid sequence from region 25-110aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 38.7 kDa
UniProt: Q6UW32
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 µg/mL can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 µg/ml can bind Human IGFL1, the EC50 is 32.33-47.52 ng/mL.