Recombinant Human Plexin-B1 (PLXNB1), partial (Active)

Artikelnummer: BYT-ORB1095873
Artikelname: Recombinant Human Plexin-B1 (PLXNB1), partial (Active)
Artikelnummer: BYT-ORB1095873
Hersteller Artikelnummer: orb1095873
Alternativnummer: BYT-ORB1095873-1,BYT-ORB1095873-100,BYT-ORB1095873-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Semaphorin receptor SEP)
This Recombinant Human Plexin-B1 (PLXNB1), partial (Active) spans the amino acid sequence from region 20-535aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 83.2 kDa
UniProt: O43157
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYG
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 µg/mL can bind human PLXNB1, the EC50 is 0.8179-1.357 µg/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D at 5 µg/ml can bind human PLXNB1, the EC50 is 0.8179-1.357 µg/ml.