Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active)

Produktübersicht

• Artikelname: Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active)
• Artikelnummer: BYT-ORB1095906
• Hersteller Artikelnummer: orb1095906
• Alternativnummer: BYT-ORB1095906-1,BYT-ORB1095906-100,BYT-ORB1095906-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cytotoxic T-lymphocyte-associated antigen 4 (CTLA-4) (CD_antigen: CD152) (CD152)

Produktbeschreibung

This Recombinant Human Cytotoxic T-lymphocyte protein 4 (CTLA4), partial (Active) spans the amino acid sequence from region 37-162aa. Purity: Greater than 91% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 42.5 kDa
• UniProt: P16410
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 91% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 µg/ml can bind Anti-CD152 rabbit monoclonal antibody, the EC50 of human CD152 protein is 27.14-34.82 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 µg/ml can bind Anti-CD152 rabbit monoclonal antibody, the EC50 of human CD152 protein is 27.14-34.82 ng/ml.

The purity of CTLA4 was greater than 90% as determined by SEC-HPLC.