Recombinant Human Egl nine homolog 1 (EGLN1), partial

Artikelnummer: BYT-ORB1096026
Artikelname: Recombinant Human Egl nine homolog 1 (EGLN1), partial
Artikelnummer: BYT-ORB1096026
Hersteller Artikelnummer: orb1096026
Alternativnummer: BYT-ORB1096026-1,BYT-ORB1096026-100,BYT-ORB1096026-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Egl nine homolog 1(EC 1.14.11.29)(Hypoxia-inducible factor prolyl hydroxylase 2)(HIF-PH2)(HIF-prolyl hydroxylase 2)(HPH-2)(Prolyl hydroxylase domain-containing protein 2)(PHD2)(SM-20)
This Recombinant Human Egl nine homolog 1 (EGLN1), partial spans the amino acid sequence from region 177-426aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 31.9 kDa
UniProt: Q9GZT9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: GGLRPNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKINGRTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
The purity of EGLN1 was greater than 90% as determined by SEC-HPLC