Recombinant Human Cystine/glutamate transporter (SLC7A11) (Active)

Artikelnummer: BYT-ORB1096292
Artikelname: Recombinant Human Cystine/glutamate transporter (SLC7A11) (Active)
Artikelnummer: BYT-ORB1096292
Hersteller Artikelnummer: orb1096292
Alternativnummer: BYT-ORB1096292-100,BYT-ORB1096292-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Amino acid transport system xc- (Calcium channel blocker resistance protein CCBR1) (Solute carrier family 7 member 11) (xCT)
This Recombinant Human Cystine/glutamate transporter (SLC7A11) (Active) spans the amino acid sequence from region 1-501aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 58.2 kDa
UniProt: Q9UPY5
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2 µg/mL can bind Anti-SLC7A11 recombinant antibody, the EC50 is 9.452-13.79 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human SLC7A11 at 2µg/mL can bind Anti-SLC7A11 recombinant antibody, the EC50 is 9.452-13.79 ng/mL.
Loaded Anti-Human SLC7A11 Antibody on 96-Flat plate, can bind Human SLC7A11, with an affinity constant of <1 pM as determined in BLI assay (Gator Prime).