Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10), partial

Artikelnummer: BYT-ORB1096610
Artikelname: Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10), partial
Artikelnummer: BYT-ORB1096610
Hersteller Artikelnummer: orb1096610
Alternativnummer: BYT-ORB1096610-20,BYT-ORB1096610-100,BYT-ORB1096610-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: ATP-dependent inwardly rectifying potassium channel Kir4.1Inward rectifier K(+) channel Kir1.2, Potassium channel, inwardly rectifying subfamily J member 10
This Recombinant Human ATP-sensitive inward rectifier potassium channel 10 (KCNJ10), partial spans the amino acid sequence from region 165-379aa. Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 39.8 kDa
UniProt: P78508
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNJ10.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) KCNJ10.