Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial

Produktübersicht

• Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial
• Artikelnummer: BYT-ORB1096689
• Hersteller Artikelnummer: orb1096689
• Alternativnummer: BYT-ORB1096689-20,BYT-ORB1096689-100,BYT-ORB1096689-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: E2 Peplomer protein

Produktbeschreibung

This Recombinant Human Novel Coronavirus Spike glycoprotein(S) (K417N),partial spans the amino acid sequence from region 319-541aa(K417N). Purity: Greater than 85% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 54.4 kDa
• UniProt: P0DTC2
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4
• Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

The purity of S was greater than 90% as determined by SEC-HPLC