Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)

Artikelnummer: BYT-ORB1096692
Artikelname: Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active)
Artikelnummer: BYT-ORB1096692
Hersteller Artikelnummer: orb1096692
Alternativnummer: BYT-ORB1096692-20,BYT-ORB1096692-100,BYT-ORB1096692-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: /
This Recombinant Human Novel Coronavirus Spike glycoprotein(S) (N501Y),partial (Active) spans the amino acid sequence from region 319-541aa(N501Y). Purity: Greater than 90% as determined by SDS-PAGE.
Molekulargewicht: 27.9 kDa
UniProt: P0DTC2
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
Reinheit: Greater than 90% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
Anwendungsbeschreibung: Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (N501Y) at 2 µg/ml can bind human ACE2, the EC50 is 12.95-17.87 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (N501Y) at 2 µg/ml can bind human ACE2, the EC50 is 12.95-17.87 ng/ml.