SOD2 Antibody (monoclonal, 2B12B1), Clone: [2B12B1], Unconjugated, Mouse, Monoclonal

Artikelnummer: BYT-ORB1145774
Artikelname: SOD2 Antibody (monoclonal, 2B12B1), Clone: [2B12B1], Unconjugated, Mouse, Monoclonal
Artikelnummer: BYT-ORB1145774
Hersteller Artikelnummer: orb1145774
Alternativnummer: BYT-ORB1145774-10,BYT-ORB1145774-100
Hersteller: Biorbyt
Wirt: Mouse
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SOD2 (192-222aa QYKNVRPDYLKAIWNVINWENVTERYMACKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by four amino acids.
Konjugation: Unconjugated
SOD2 Antibody (monoclonal, 2B12B1)
Klonalität: Monoclonal
Konzentration: Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.
Klon-Bezeichnung: [2B12B1]
Molekulargewicht: 25 kDa
UniProt: P04179
Formulierung: Lyophilized
Application Verdünnung: Western blot, 0.25-0.5 µg/ml, Human, Mouse Immunohistochemistry(Paraffin-embedded Section), 2-5 µg/ml, Human
Anwendungsbeschreibung: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Adding 0.2 ml of distilled water will yield a concentration of 500 µg/ml.