NSP12 (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463306
Artikelname: NSP12 (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463306
Hersteller Artikelnummer: orb1463306
Alternativnummer: BYT-ORB1463306-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp12 (residues 820 to stop) and produced in E. coli. Antigen Sequence: MPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEF YEAMYTPHTVLQ
Konjugation: Unconjugated
Alternative Synonym: Nsp12 SARS Coronavirus-2, RNA-directed RNA polymerase antibody., sars-cov-2
Nsp12 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural, RNA-directed RNA polymerase is responsible for replication and transcription of the viral RNA genome.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: NSP12 (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use