Spike RBD Domain (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463309
Artikelname: Spike RBD Domain (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463309
Hersteller Artikelnummer: orb1463309
Alternativnummer: BYT-ORB1463309-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the spike protein RBD domain (residues 343 to 400) and produced in E. coli.. Antigen Sequence: NATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSF
Konjugation: Unconjugated
Alternative Synonym: S glycoprotein SARS Coronavirus-2, Spike RBD Domain SARS Coronavirus-2 antibody., sars-cov-2
The spike or S glycoprotein is a transmembrane protein with a molecular weight of about 150 kDa found in the outer portion of the SARS-CoV-2 virus. This protein is composed of two subunits, S1 and S2 and plays a key role in the receptor recognition and cell membrane fusion process. The S1 subunit contains a receptor-binding domain that recognizes and binds to the host receptor angiotensin-converting enzyme 2, while the S2 subunit mediates viral cell membrane fusion.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: Spike RBD Domain (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use