NSP3 (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463325
Artikelname: NSP3 (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463325
Hersteller Artikelnummer: orb1463325
Alternativnummer: BYT-ORB1463325-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein using the C-terminal of Nsp3 (residues 1846 to stop) and produced in E. coli.. Antigen Sequence: MEVTGDSCNNYMLTYNKVENMTPRDLGACIDCSARHINAQVAKSHNIALIWNVKDFMSLSEQLRKQIRSAAKKNNLPFKLTCATTRQVVNVVTTKIALKGG
Konjugation: Unconjugated
Alternative Synonym: Nsp3 SARS Coronavirus-2 antibody., sars-cov-2
Nsp3 is part of the multifunctional protein replicase polyprotein 1ab that is involved in the transcription and replication of viral RNA. This non-structural protein has been implicated on several mechanisms such as the cleavage located at the N-terminus of the replicase polyprotein and rearrangement of host membrane that leads to creation of cytoplasmic double-membrane vesicles (DMV) necessary for viral replication.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: NSP3 (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use