ORF7a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal

Artikelnummer: BYT-ORB1463329
Artikelname: ORF7a (SARS-CoV-2) Antibody, Unconjugated, Goat, Polyclonal
Artikelnummer: BYT-ORB1463329
Hersteller Artikelnummer: orb1463329
Alternativnummer: BYT-ORB1463329-100
Hersteller: Biorbyt
Wirt: Goat
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Virus
Immunogen: Antigen: Affinity purified recombinant fusion protein ORF7a (residues 18 to 95) produced in E. coli.. Antigen Sequence: MYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQE
Konjugation: Unconjugated
Alternative Synonym: ORF7a SARS Coronavirus-2 antibody., sars-cov-2
ORF7a is a SARS-CoV accessory protein that is composed of a type I transmembrane protein that localizes primarily to the Golgi apparatus and also be found on the cell surface. This protein has been implicated on several mechanisms such as suppressing both transgene and virus-induced gene silencing by reducing the levels of small interfering RNA (siRNA), attachment and modulation of leukocytes by biding to host ITGAL and playing a role as antagonist of host tetherin (BST2) by disrupting its antiviral effect.
Klonalität: Polyclonal
Konzentration: 1 mg/ml
Puffer: PBS, 20% glycerol and 0.05% sodium azide
Target-Kategorie: ORF7a (SARS-CoV-2)
Application Verdünnung: WB:1:500-1:2,000
Anwendungsbeschreibung: Application Notes: The antibody solution should be gently mixed before use