Human CEACAM6 Protein

Produktübersicht

• Artikelname: Human CEACAM6 Protein
• Artikelnummer: BYT-ORB1476703
• Hersteller Artikelnummer: orb1476703
• Alternativnummer: BYT-ORB1476703-1,BYT-ORB1476703-100,BYT-ORB1476703-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Non-specific crossreacting antigen)(Normal cross-reacting antigen)(CD66c)

Produktbeschreibung

This Human CEACAM6 Protein spans the amino acid sequence from region 35-320aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 32.6 kDa
• UniProt: P40199
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNI

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 µg/mL can bind Human CEACAM8, the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 µg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody, the EC50 is 0.9430-1.377 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 µg/mL can bind Human CEACAM8, the EC50 is 144.7-223.8 ng/mL.

Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 µg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody, the EC50 is 0.9430-1.377 ng/mL.