Human DSG3 Protein

Artikelnummer: BYT-ORB1476705
Artikelname: Human DSG3 Protein
Artikelnummer: BYT-ORB1476705
Hersteller Artikelnummer: orb1476705
Alternativnummer: BYT-ORB1476705-1,BYT-ORB1476705-100,BYT-ORB1476705-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (130 kDa pemphigus vulgaris antigen)(PVA)(Cadherin family member 6)
This Human DSG3 Protein spans the amino acid sequence from region 50-615aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 63.8 kDa
UniProt: P32926
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: EWVKFAKPCREGEDNSKRNPIAKITSDYQATQKITYRISGVGIDQPPFGIFVVDKNTGDINITAIVDREETPSFLITCRALNAQGLDVEKPLILTVKILDINDNPPVFSQQIFMGEIEENSASNSLVMILNATDADEPNHLNSKIAFKIVSQEPAGTPMFLLSRNTGEVRTLTNSLDREQASSYRLVVSGADKDGEGLSTQCECNIKVKDVNDNFPMFRDSQYSARIEENILSSELLRFQVTDLDEEYTDNWLAV
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human DSG3 at 2 µg/mL can bind Anti-DSG3 recombinant antibody, the EC50 is 4.552-5.720 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human DSG3 at 2 µg/mL can bind Anti-DSG3 recombinant antibody, the EC50 is 4.552-5.720 ng/mL.