Mouse Cd93 Protein

Artikelnummer: BYT-ORB1476711
Artikelname: Mouse Cd93 Protein
Artikelnummer: BYT-ORB1476711
Hersteller Artikelnummer: orb1476711
Alternativnummer: BYT-ORB1476711-1,BYT-ORB1476711-100,BYT-ORB1476711-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (C1q/MBL/SPA receptor)(C1qR(p))(C1qRp)(Cell surface antigen AA4)(Complement component 1 q subcomponent receptor 1)(Lymphocyte antigen 68)(Ly-68)(CD antigen CD93)
This Mouse Cd93 Protein spans the amino acid sequence from region 23-572aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 60.9 kDa
UniProt: O89103
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Mus musculus (Mouse)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: ADSQAVVCEGTACYTAHWGKLSAAEAQHRCNENGGNLATVKSEEEARHVQQALTQLLKTKAPLEAKMGKFWIGLQREKGNCTYHDLPMRGFSWVGGGEDTAYSNWYKASKSSCIFKRCVSLILDLSLTPHPSHLPKWHESPCGTPEAPGNSIEGFLCKFNFKGMCRPLALGGPGRVTYTTPFQATTSSLEAVPFASVANVACGDEAKSETHYFLCNEKTPGIFHWGSSGPLCVSPKFGCSFNNGGCQQDCFEGGD
Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse CD93 at 2 µg/mL can bind Mouse IGFBP7, the EC50 is 373.4-836.8 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Mouse CD93 at 2 µg/mL can bind Mouse IGFBP7, the EC50 is 373.4-836.8 ng/mL.