Human MAPT Protein

Artikelnummer: BYT-ORB1477115
Artikelname: Human MAPT Protein
Artikelnummer: BYT-ORB1477115
Hersteller Artikelnummer: orb1477115
Alternativnummer: BYT-ORB1477115-20,BYT-ORB1477115-100,BYT-ORB1477115-1
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: (Neurofibrillary tangle protein)(Paired helical filament-tau)(PHF-tau)
This Human MAPT Protein spans the amino acid sequence from region 1-441aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 49.5 kDa
UniProt: P10636
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTPTAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKN
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MAPT at 2 µg/ml can bind Anti-MAPT recombinant antibody, the EC50 is 4.547-6.284 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human MAPT at 2 µg/ml can bind Anti-MAPT recombinant antibody, the EC50 is 4.547-6.284 ng/mL.