Mouse Transthyretin Protein

Produktübersicht

• Artikelname: Mouse Transthyretin Protein
• Artikelnummer: BYT-ORB1477842
• Hersteller Artikelnummer: orb1477842
• Alternativnummer: BYT-ORB1477842-1,BYT-ORB1477842-100,BYT-ORB1477842-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (Prealbumin)

Produktbeschreibung

This Mouse Transthyretin Protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 16.4 kDa
• UniProt: P07309
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: GPAGAGESKCPLMVKVLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWKTLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYSTTAVVSNPQN

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 µg/mL can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Mouse Ttr at 5 µg/ml can bind Mouse Rbp4, the EC50 is 17.06-26.23 ng/mL.