Human TRIM72 Protein

Produktübersicht

• Artikelname: Human TRIM72 Protein
• Artikelnummer: BYT-ORB1478114
• Hersteller Artikelnummer: orb1478114
• Alternativnummer: BYT-ORB1478114-1,BYT-ORB1478114-100,BYT-ORB1478114-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: (Mitsugumin-53)(Mg53)

Produktbeschreibung

Recombinant Human Tripartite motif-containing protein 72(TRIM72),partial

Produkteigenschaften

• Molekulargewicht: 34.5 kDa
• UniProt: Q6ZMU5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPTRPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLLPAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMRVFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMKYCLVTSRLQKILAE

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration