Human SSTR2-VLPs Protein

Produktübersicht

• Artikelname: Human SSTR2-VLPs Protein
• Artikelnummer: BYT-ORB1478128
• Hersteller Artikelnummer: orb1478128
• Alternativnummer: BYT-ORB1478128-20,BYT-ORB1478128-100,BYT-ORB1478128-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: SSTR2, Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

Produktbeschreibung

This Human SSTR2-VLPs Protein spans the sequence from region 1-369aa.

Produkteigenschaften

• Molekulargewicht: 42.5 kDa
• UniProt: P30874
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Homo sapiens (Human)
• Formulierung: Lyophilized powder
• Sequenz: MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVT

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 µg/ml can bind Anti-SSTR2 recombinant antibody, the EC50 is 58.13-81.28 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Bilder

Detected by Mouse anti-6*His monoclonal antibody.

Measured by its binding ability in a functional ELISA. Immobilized Human SSTR2 at 10 µg/ml can bind Anti-SSTR2 recombinant antibody, the EC50 is 58.13-81.28 ng/mL.

The presence of VLP-like structures was confirmed by TEM

Blocking experiment on Anti-SSTR2 antibody between Human SSTR2-VLPs protein and CT26/Human SSTR2 Stable Cells by Flow cytometry.