Human CXCR4-VLPs Protein

Produktübersicht

• Artikelname: Human CXCR4-VLPs Protein
• Artikelnummer: BYT-ORB1478130
• Hersteller Artikelnummer: orb1478130
• Alternativnummer: BYT-ORB1478130-1,BYT-ORB1478130-100,BYT-ORB1478130-20
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: (CXC-R4)(CXCR-4)(FB22)(Fusin)(HM89)(LCR1)(Leukocyte-derived seven transmembrane domain receptor)(LESTR)(Lipopolysaccharide-associated protein 3)(LAP-3)(LPS-associated protein 3)(NPYRL)(Stromal cell-derived factor 1 receptor)(SDF-1 receptor)(CD antigen CD184)

Produktbeschreibung

This Human CXCR4-VLPs Protein spans the sequence from region 1-352aa.

Produkteigenschaften

• Molekulargewicht: 41.5 kDa
• UniProt: P61073
• Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
• Quelle: Homo sapiens (Human)
• Formulierung: Lyophilized powder
• Sequenz: MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVILILAFFACWLPY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CXCR4 at 10 µg/mL can bind Anti-CXCR4 recombinant antibody, the EC50 is 101.7-253.6 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing

Bilder

Detected by Mouse anti-6*His monoclonal antibody.

Measured by its binding ability in a functional ELISA. Immobilized Human CXCR4 at 10 µg/ml can bind Anti-CXCR4 recombinant antibody, the EC50 is 101.7-253.6 ng/mL.