PVRL2/CD112 Antibody, Unconjugated, Rabbit, Polyclonal

Artikelnummer: BYT-ORB1536657
Artikelname: PVRL2/CD112 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer: BYT-ORB1536657
Hersteller Artikelnummer: orb1536657
Alternativnummer: BYT-ORB1536657-50
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IF, IHC, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 382-479 of human PVRL2 (NP_002847.1). FILLRVRRRRKSPGGAGGGASGDGGFYDPKAQVLGNGDPVFWTPVVPGPMEPDGKDEEEEEEEEKAEKGLMLPPPPALEDDMESQLDGSLISRRAVYV
Konjugation: Unconjugated
Alternative Synonym: PVRL2, HVEB, Herpesvirus entry protein B, Poliovirus receptor-like 2, Nectin-2, PRR2, PVRR2, CD112, CD112 antigen, Herpes virus entry mediator B, Herpesvirus entry mediator B, NECTIN2
PVRL2/CD112 Antibody
Klonalität: Polyclonal
Konzentration: 1.22 mg/ml
Puffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
Target-Kategorie: PVRL2 / CD112
Application Verdünnung: IF (1:50 - 1:200), IHC (1:50 - 1:200), IHC-P (1:200), WB (1:500 - 1:2000)
Anwendungsbeschreibung: Application Notes: Further information: The predicted MW is 51kDa/57kDa, while the observed MW by Western blot was 72kDa
Immunofluorescence analysis of HeLa cells.
Western blot analysis of extracts of various cell lines.