Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial

Produktübersicht

• Artikelname: Recombinant Human Interleukin-12 receptor subunit beta-1 (IL12RB1), partial
• Artikelnummer: BYT-ORB1674324
• Hersteller Artikelnummer: orb1674324
• Alternativnummer: BYT-ORB1674324-20,BYT-ORB1674324-100,BYT-ORB1674324-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: (IL-12 receptor subunit beta-1)(IL-12R subunit beta-1)(IL-12R-beta-1)(IL-12RB1)(IL-12 receptor beta component)(CD212)

Produktbeschreibung

Recombinant Human Interleukin-12 receptor subunit beta-1(IL12RB1),partial

Produkteigenschaften

• Molekulargewicht: 60.4 kDa
• UniProt: P42701
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPTAGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYEPPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQLRRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPG

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration