Recombinant Rat Purine nucleoside phosphorylase (Pnp)

Produktübersicht

• Artikelname: Recombinant Rat Purine nucleoside phosphorylase (Pnp)
• Artikelnummer: BYT-ORB1674331
• Hersteller Artikelnummer: orb1674331
• Alternativnummer: BYT-ORB1674331-20,BYT-ORB1674331-100,BYT-ORB1674331-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Rat
• Alternative Synonym: (PNP)(Inosine phosphorylase)(Inosine-guanosine phosphorylase)

Produktbeschreibung

Recombinant Rat Purine nucleoside phosphorylase(Pnp)

Produkteigenschaften

• Molekulargewicht: 33.1 kDa
• UniProt: P85973
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Rattus norvegicus (Rat)
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MENEFTYEDYQRTAEWLRSHTKHRPQVAVICGSGLGGLTAKLTQPQAFDYNEIPNFPQSTVQGHAGRLVFGFLNGRSCVMMQGRFHMYEGYSLSKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFCGQNPLRGPNDERFGVRFPAMSDAYDRDMRQKAFNAWKQMGEQRELQEGTYIMSAGPTFETVAESCLLRMLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVVMDYNNLEK

Anwendungsbeschreibung

• Anwendungsbeschreibung: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration