Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)

Artikelnummer: BYT-ORB1674365
Artikelname: Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active)
Artikelnummer: BYT-ORB1674365
Hersteller Artikelnummer: orb1674365
Alternativnummer: BYT-ORB1674365-1,BYT-ORB1674365-100,BYT-ORB1674365-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
This Recombinant Macaca fascicularis lymphocyte antigen 6 family member G6D (LY6G6D) (Active) spans the amino acid sequence from region 20-104aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 11.1 kDa
Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Quelle: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAARHCNQVETESVGDVTYPAHRDCYLGDLCNS
Anwendungsbeschreibung: Biological Origin: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 µg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis LY6G6D at 2 µg/mL can bind Anti-LY6G6D recombinant antibody, the EC50 is 3.963-7.154 ng/mL.