Recombinant Human Delta-like protein 3 (DLL3), partial (Active)

Artikelnummer: BYT-ORB1785016
Artikelname: Recombinant Human Delta-like protein 3 (DLL3), partial (Active)
Artikelnummer: BYT-ORB1785016
Hersteller Artikelnummer: orb1785016
Alternativnummer: BYT-ORB1785016-1,BYT-ORB1785016-100,BYT-ORB1785016-20
Hersteller: Biorbyt
Kategorie: Proteine/Peptide
Alternative Synonym: Delta-like protein 3, Drosophila Delta homolog 3 (Delta3)
This Recombinant Human Delta-like protein 3 (DLL3), partial (Active) spans the amino acid sequence from region 391-492aa. Purity: Greater than 95% as determined by SDS-PAGE.
Molekulargewicht: 11.7 kDa
UniProt: Q9NYJ7
Puffer: Lyophilized from a 0.2 µm sterile filtered PBS, 6% Trehalose, pH 7.4.
Quelle: Homo sapiens (Human)
Reinheit: Greater than 95% as determined by SDS-PAGE.
Formulierung: Lyophilized powder
Sequenz: DLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYL
Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 µg/mL can bind Anti-DLL3 recombinant antibody. The EC50 is 1.107-1.282 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized Human DLL3 at 2 µg/ml can bind Anti-DLL3 recombinant antibody. The EC50 is 1.107-1.282 ng/mL.
The purity of DLL3 was greater than 95% as determined by SEC-HPLC