Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) (Active)

Produktübersicht

• Artikelname: Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) (Active)
• Artikelnummer: BYT-ORB1785085
• Hersteller Artikelnummer: orb1785085
• Alternativnummer: BYT-ORB1785085-20,BYT-ORB1785085-100,BYT-ORB1785085-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: 20 kDa myosin light chain, LC20, MLC-2C, Myosin RLC, Myosin regulatory light chain 2, smooth muscle isoform, Myosin regulatory light chain 9, Myosin regulatory light chain MRLC1

Produktbeschreibung

This Recombinant Human Myosin regulatory light polypeptide 9 (MYL9) (Active) spans the amino acid sequence from region 2-172aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 21.7 kDa
• UniProt: P24844
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Homo sapiens (Human)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: SSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Homo sapiens (Human). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2 µg/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 4.628-6.430 ng/mL. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Human MYL9 at 2µg/mL can bind Anti-MYL9 recombinant antibody, the EC50 is 4.628-6.430 ng/mL.