Recombinant Mouse CUB domain-containing protein 1 (Cdcp1), partial (Active)

Produktübersicht

• Artikelname: Recombinant Mouse CUB domain-containing protein 1 (Cdcp1), partial (Active)
• Artikelnummer: BYT-ORB1785089
• Hersteller Artikelnummer: orb1785089
• Alternativnummer: BYT-ORB1785089-20,BYT-ORB1785089-100,BYT-ORB1785089-1
• Hersteller: Biorbyt
• Kategorie: Proteine/Peptide
• Alternative Synonym: CUB domain-containing protein 1, Membrane glycoprotein gp140, Transmembrane and associated with src kinases,CD318, Cdcp1

Produktbeschreibung

This Recombinant Mouse CUB domain-containing protein 1 (Cdcp1), partial (Active) spans the amino acid sequence from region 30-666aa. Purity: Greater than 95% as determined by SDS-PAGE.

Produkteigenschaften

• Molekulargewicht: 73.2 kDa
• UniProt: Q5U462
• Puffer: Lyophilized from a 0.2 µm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Quelle: Mus musculus (Mouse)
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Lyophilized powder
• Sequenz: SEIALPQRSGVTVSIKLGNPALPVKICYIVMSRQHITELIIRPGERKSFTFSCSNPEKHFVLKIEKNIDCMSGPCPFGEVHLQPSTSELPILNRTFIWDVRAHKSIGLELQFATPRLRQIGPGESCADGVTHSISGHIDATEVRIGTFCSNGTVSRIKMQEGVKMALHLPWFHRRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANYPGGFPEDELMTWQFVVPAHLRASVSFLNFNVSNCERKEERVEYY

Anwendungsbeschreibung

• Anwendungsbeschreibung: Biological Origin: Mus musculus (Mouse). Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Mouse Cdcp1 at 2 µg/mL can bind Anti-CDCP1 recombinant antibody, the EC50 is 0.6397-0.8369 ng/ml. Application Notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference

Bilder

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized Mouse Cdcp1 at 2 µg/mL can bind Anti-CDCP1 recombinant antibody, the EC50 is 0.6397-0.8369 ng/mL.